Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUB1 protein

This Human SUB1 protein spans the amino acid sequence from region 2-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SUB1

UniProt

P53999

Expression Region

2-127aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-127aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM50 Antibody (N-term)
MBS9212488-01 0.08 mL

TIMM50 Antibody (N-term)

Sign In for Pricing
View Details
TIMM50 Antibody (N-term)
MBS9212488-02 0.4 mL

TIMM50 Antibody (N-term)

Sign In for Pricing
View Details
TIMM50 Antibody (N-term)
MBS9212488-03 5x 0.4 mL

TIMM50 Antibody (N-term)

Sign In for Pricing
View Details
TMEM223 (NM_001080501) Human Over-expression Lysate
LH05073V 100 µg

TMEM223 (NM_001080501) Human Over-expression Lysate

Sign In for Pricing
View Details
EPZ020411 hydrochloride 1mg
A21802-1 1 mg

EPZ020411 hydrochloride 1mg

Sign In for Pricing
View Details
Rabbit Polyclonal TLR6 Antibody [Alexa Fluor 700]
NBP1-76664AF700 0.1 mL

Rabbit Polyclonal TLR6 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details