Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XRCC6 protein

This Human XRCC6 protein spans the amino acid sequence from region 6-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XRCC6, G22P1

UniProt

P12956

Expression Region

6-222aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLC1 Rabbit Polyclonal Antibody
TA359769 100 µL

KLC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHD Antibody : HRP (OAAF04277-HRP)
OAAF04277-100UG-HRP 100 µg

SHD Antibody : HRP (OAAF04277-HRP)

Sign In for Pricing
View Details
OSMR siRNA (Rat)
orb1828670-01 15 nmol

OSMR siRNA (Rat)

Sign In for Pricing
View Details
OSMR siRNA (Rat)
orb1828670-02 30 nmol

OSMR siRNA (Rat)

Sign In for Pricing
View Details
Mouse Abhd18 (NM_026622) AAV Particle
MR212457A1V 250 µL

Mouse Abhd18 (NM_026622) AAV Particle

Sign In for Pricing
View Details
EXOC6 Protein Vector (Rat) (pPM-C-HA)
19567026 500 ng

EXOC6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details