Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFB7 protein

This Human NDUFB7 protein spans the amino acid sequence from region 2-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFB7

UniProt

P17568

Expression Region

2-137aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive), DELXp11.3, KIAA0215, TBCCD2) (PE)
251238-PE 100 µL

RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive), DELXp11.3, KIAA0215, TBCCD2) (PE)

Sign In for Pricing
View Details
Fmoc-Ser (Tbu) -Oh
RM-F131529-01 10 mg

Fmoc-Ser (Tbu) -Oh

Sign In for Pricing
View Details
Fmoc-Ser (Tbu) -Oh
RM-F131529-02 25 mg

Fmoc-Ser (Tbu) -Oh

Sign In for Pricing
View Details
Fmoc-Ser (Tbu) -Oh
RM-F131529-03 50 mg

Fmoc-Ser (Tbu) -Oh

Sign In for Pricing
View Details
Fmoc-Ser (Tbu) -Oh
RM-F131529-04 100 mg

Fmoc-Ser (Tbu) -Oh

Sign In for Pricing
View Details
Lentiviral mouse Drd3 shRNA (UAS) - Lentiviral mouse Drd3 shRNA (UAS, iRFP) (25)
GTR15266498 1 Vial

Lentiviral mouse Drd3 shRNA (UAS) - Lentiviral mouse Drd3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details