Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STAT3 protein

This Human STAT3 protein spans the amino acid sequence from region 50-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

STAT3

UniProt

P40763

Expression Region

50-240aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 50-240aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(D-Ala2)-GRF (1-29) amide (human)
H-3715.0500 0.5mg

(D-Ala2)-GRF (1-29) amide (human)

Sign In for Pricing
View Details
CSTF1 Blocking Peptide
MBS9623420-01 1 mg

CSTF1 Blocking Peptide

Sign In for Pricing
View Details
CSTF1 Blocking Peptide
MBS9623420-02 5x 1 mg

CSTF1 Blocking Peptide

Sign In for Pricing
View Details
Fibrillarin Rabbit mAb
F3066-100uL*2 2x 100 μL

Fibrillarin Rabbit mAb

Sign In for Pricing
View Details
Porcine Slit Homolog 3 ELISA Kit
MBS072027-01 48 Well

Porcine Slit Homolog 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Slit Homolog 3 ELISA Kit
MBS072027-02 96 Well

Porcine Slit Homolog 3 ELISA Kit

Sign In for Pricing
View Details