Mouse Sry Tdf Tdy protein
This Mouse Sry Tdf Tdy protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sry Tdf Tdy
UniProt
Q05738
Expression Region
1-144aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial of His-tag and expression region is 1-144aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2791-500 1x 500 µL
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSM040869 100 µg
Recombinant Mouse Fetuin-A/AHSG Protein (His Tag)
Sign In for Pricing
View Details 
![PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2a3e/imageurl/e-ab-f1143j.webp)
E-AB-F1143J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]
Sign In for Pricing
View Details E-AB-F1143J-02 100 Tests
PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]
Sign In for Pricing
View Details