Mouse Sry Tdf Tdy protein
This Mouse Sry Tdf Tdy protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sry Tdf Tdy
UniProt
Q05738
Expression Region
1-144aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial of His-tag and expression region is 1-144aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VK741014-01 50 µg
Anti-Monkeypox virus/MPXV D13L Polyclonal Antibody
Sign In for Pricing
View Details VK741014-02 100 µg
Anti-Monkeypox virus/MPXV D13L Polyclonal Antibody
Sign In for Pricing
View Details JOT-EK2001Mo-01 48 Well
Mouse dentin sialophosphoprotein,DSPP ELISA KIT
Sign In for Pricing
View Details JOT-EK2001Mo-02 96 Well
Mouse dentin sialophosphoprotein,DSPP ELISA KIT
Sign In for Pricing
View Details 
ZUD28552-01 25 mg
(E) -6-Fluoro-2- (2- (5-nitrofuran-2-yl) vinyl) -3-phenylquinazolin-4 (3H) -one
Sign In for Pricing
View Details