Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SRP19 protein

This Human SRP19 protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SRP19

UniProt

P09132

Expression Region

2-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-144aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Albumin (ALB) ELISA Kit
orb2812165-01 48 Tests

Mouse Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
Mouse Albumin (ALB) ELISA Kit
orb2812165-02 96 Tests

Mouse Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
Mouse Albumin (ALB) ELISA Kit
orb2812165-03 5 x 96 T

Mouse Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
SIX2 Protein Vector (Mouse) (pPB-N-His)
PV229363 500 ng

SIX2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem II reaction center protein J (psbJ)
MBS1092020 Inquire

Recombinant Prochlorococcus marinus Photosystem II reaction center protein J (psbJ)

Sign In for Pricing
View Details
Bersanlimab Human Monoclonal Antibody
orb2978406-01 100 µg

Bersanlimab Human Monoclonal Antibody

Sign In for Pricing
View Details