Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SRP19 protein

This Human SRP19 protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SRP19

UniProt

P09132

Expression Region

2-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-144aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAT3 shRNA (UAS) - Lentiviral human FAT3 shRNA (UAS, GFP) (100)
GTR15342144 1 Vial

Lentiviral human FAT3 shRNA (UAS) - Lentiviral human FAT3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
2,4,6-Trichlorophenyl 2-phenyl-1-ethylenesulfonate
sc-308839A 1 g

2,4,6-Trichlorophenyl 2-phenyl-1-ethylenesulfonate

Sign In for Pricing
View Details
Recombinant Mouse AAAS Protein, His (Fc)-Avi-tagged
AAAS-168M 50 µg

Recombinant Mouse AAAS Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Chlorinated phenols, Total IgG (0,2mg)
AS11 1664 0.2 mg

Chlorinated phenols, Total IgG (0,2mg)

Sign In for Pricing
View Details
Cytokeratin 8 antibody
70R-13833 0.1 mg

Cytokeratin 8 antibody

Sign In for Pricing
View Details
5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine
sc-290797 250 mg

5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine

Sign In for Pricing
View Details