Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PFDN1 protein

This Human PFDN1 protein spans the amino acid sequence from region 2-122. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PFDN1

UniProt

O60925

Expression Region

2-122

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SRARP shRNA (UAS) - Lentiviral human SRARP shRNA (UAS) (25)
GTR15118205 1 Vial

Lentiviral human SRARP shRNA (UAS) - Lentiviral human SRARP shRNA (UAS) (25)

Sign In for Pricing
View Details
Emd (NM_007927) Mouse Recombinant Protein
E45M43329M5 20 µg

Emd (NM_007927) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal CD8 Antibody (SPM548) - Azide and BSA Free
NBP2-34790-0.1mg 0.1 mg

Mouse Monoclonal CD8 Antibody (SPM548) - Azide and BSA Free

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3171R), CF568 conjugate, 0.1mg/mL
BNC683171-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/3171R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgM Antibody (H+L), Cy5.5 Conjugated
bs-0368R-Cy5.5 200 µL

Rabbit Anti-Mouse IgM Antibody (H+L), Cy5.5 Conjugated

Sign In for Pricing
View Details
Cyclo (-Asp-Phe)
4016611.1000 1 g

Cyclo (-Asp-Phe)

Sign In for Pricing
View Details