Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PFDN1 protein

This Human PFDN1 protein spans the amino acid sequence from region 2-122. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PFDN1

UniProt

O60925

Expression Region

2-122

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV653386 1.0 µg DNA

STAU1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal CD59 Antibody (MACIF/629) [DyLight 550]
NBP2-47820R 0.1 mL

Mouse Monoclonal CD59 Antibody (MACIF/629) [DyLight 550]

Sign In for Pricing
View Details
Rnf215 sgRNA CRISPR Lentivector set (Rat)
K6170001 3x 1.0 µg

Rnf215 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse FYCO1 siRNA
abx917350-01 15 nmol

Mouse FYCO1 siRNA

Sign In for Pricing
View Details
Mouse FYCO1 siRNA
abx917350-02 30 nmol

Mouse FYCO1 siRNA

Sign In for Pricing
View Details
Recombinant Burkholderia phymatum NADH-quinone oxidoreductase subunit H (nuoH), partial
MBS1211296-01 1 mg (E-Coli)

Recombinant Burkholderia phymatum NADH-quinone oxidoreductase subunit H (nuoH), partial

Sign In for Pricing
View Details