Rat Sort1 protein
This Rat Sort1 protein spans the amino acid sequence from region 610-754aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sort1
UniProt
O54861
Expression Region
610-754aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Interactions with LRPAP1 and NGFB domain of His-SUMO-tag and expression region is 610-754aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AM20829PU-S 100 µg
Rat IgG Light Chain mouse monoclonal antibody, clone KT100, Aff - Purified
Sign In for Pricing
View Details MBS057850-01 48 Well
Canine Protein Phosphatase 2A Activator, Regulatory Subunit 4 ELISA Kit
Sign In for Pricing
View Details MBS057850-02 96 Well
Canine Protein Phosphatase 2A Activator, Regulatory Subunit 4 ELISA Kit
Sign In for Pricing
View Details MBS057850-03 5x 96 Well
Canine Protein Phosphatase 2A Activator, Regulatory Subunit 4 ELISA Kit
Sign In for Pricing
View Details MBS057850-04 10x 96 Well
Canine Protein Phosphatase 2A Activator, Regulatory Subunit 4 ELISA Kit
Sign In for Pricing
View Details 