Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PROS26 protein

This Human PROS26 protein spans the amino acid sequence from region 46-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PROS26

UniProt

P28070

Expression Region

46-264aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp6v1c2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6322002 1.0 µg DNA

Atp6v1c2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RAPGEFL1 Peptide - C-terminal region
MBS3243800-01 0.1 mg

RAPGEFL1 Peptide - C-terminal region

Sign In for Pricing
View Details
RAPGEFL1 Peptide - C-terminal region
MBS3243800-02 5x 0.1 mg

RAPGEFL1 Peptide - C-terminal region

Sign In for Pricing
View Details
TIMM17A (NM_006335) Human Tagged ORF Clone Lentiviral Particle
RC205025L3V 200 µL

TIMM17A (NM_006335) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PE Anti-Mouse CD62L (L-Selectin) (MEL-14)
orb1215285-01 25 µg

PE Anti-Mouse CD62L (L-Selectin) (MEL-14)

Sign In for Pricing
View Details
PE Anti-Mouse CD62L (L-Selectin) (MEL-14)
orb1215285-02 100 µg

PE Anti-Mouse CD62L (L-Selectin) (MEL-14)

Sign In for Pricing
View Details