Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNCG protein

This Human SNCG protein spans the amino acid sequence from region 1-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCG

UniProt

O76070

Expression Region

1-127aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-127aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STON2 Antibody Picoband®, Cy3 Conjugate
A10624-Cy3 100 µg/Vial

Anti-STON2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Methyl 5-formylpyrazolo[1,5-a]pyridine-3-carboxylate
LMB63797-01 100 mg

Methyl 5-formylpyrazolo[1,5-a]pyridine-3-carboxylate

Sign In for Pricing
View Details
Methyl 5-formylpyrazolo[1,5-a]pyridine-3-carboxylate
LMB63797-02 1 g

Methyl 5-formylpyrazolo[1,5-a]pyridine-3-carboxylate

Sign In for Pricing
View Details
Apolipoprotein Lp (a) (Apo Lp-a) (APC) discontinued
L2600-13-APC 100 µL

Apolipoprotein Lp (a) (Apo Lp-a) (APC) discontinued

Sign In for Pricing
View Details
TLE4, NT (TLE4, KIAA1261, Transducin-like enhancer protein 4) (MaxLight 490)
MBS6355806-01 0.1 mL

TLE4, NT (TLE4, KIAA1261, Transducin-like enhancer protein 4) (MaxLight 490)

Sign In for Pricing
View Details
TLE4, NT (TLE4, KIAA1261, Transducin-like enhancer protein 4) (MaxLight 490)
MBS6355806-02 5x 0.1 mL

TLE4, NT (TLE4, KIAA1261, Transducin-like enhancer protein 4) (MaxLight 490)

Sign In for Pricing
View Details