Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSMB7 protein

This Human PSMB7 protein spans the amino acid sequence from region 44-275aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSMB7

UniProt

Q99436

Expression Region

44-275aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM3B Polyclonal Antibody
RD89499A-01 60 μL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
KDM3B Polyclonal Antibody
RD89499A-02 120 μL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
KDM3B Polyclonal Antibody
RD89499A-03 200 µL

KDM3B Polyclonal Antibody

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Loricrin (LOR)
MBS2066735-01 0.1 mL

PE-Linked Polyclonal Antibody to Loricrin (LOR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Loricrin (LOR)
MBS2066735-02 0.2 mL

PE-Linked Polyclonal Antibody to Loricrin (LOR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Loricrin (LOR)
MBS2066735-03 0.5 mL

PE-Linked Polyclonal Antibody to Loricrin (LOR)

Sign In for Pricing
View Details