Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMCP protein

This Human SMCP protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SMCP

UniProt

P49901

Expression Region

1-116aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-116aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-beta Amyloid/APP Antibody Picoband® (Biotine Conjugate)
PB9091-Biotin 100 µg/Vial

Anti-beta Amyloid/APP Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
CD99 ORF Vector (Human) (pORF)
ORF002150 1.0 µg DNA

CD99 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
BRCA1 antibody (Ser1423)
70R-37305 0.1 mg

BRCA1 antibody (Ser1423)

Sign In for Pricing
View Details
3- (2,3-Dihydro-1,4-benzodioxin-6-yl) tetrahydro-3-furanol
OR1082449-01 250 mg

3- (2,3-Dihydro-1,4-benzodioxin-6-yl) tetrahydro-3-furanol

Sign In for Pricing
View Details
3- (2,3-Dihydro-1,4-benzodioxin-6-yl) tetrahydro-3-furanol
OR1082449-02 500 mg

3- (2,3-Dihydro-1,4-benzodioxin-6-yl) tetrahydro-3-furanol

Sign In for Pricing
View Details
3- (2,3-Dihydro-1,4-benzodioxin-6-yl) tetrahydro-3-furanol
OR1082449-03 1 g

3- (2,3-Dihydro-1,4-benzodioxin-6-yl) tetrahydro-3-furanol

Sign In for Pricing
View Details