Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIVA1 protein

This Human SIVA1 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SIVA1

UniProt

O15304

Expression Region

1-110aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-SUMO-tag and expression region is 1-110aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAG3/CD223 Protein (Fc Tag)
PKSH030460-01 50 µg

Recombinant Human LAG3/CD223 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (Fc Tag)
PKSH030460-02 500 µg

Recombinant Human LAG3/CD223 Protein (Fc Tag)

Sign In for Pricing
View Details
DL-Homocysteic-3,3,4,4-d4 Acid
TRC-H591299-1MG 1 mg

DL-Homocysteic-3,3,4,4-d4 Acid

Sign In for Pricing
View Details
Human CDRT1 activation kit by CRISPRa
GA117756 1 Kit

Human CDRT1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S Protein HR1
PKSV030306-01 50 µg

Recombinant SARS-CoV-2 S Protein HR1

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S Protein HR1
PKSV030306-02 500 µg

Recombinant SARS-CoV-2 S Protein HR1

Sign In for Pricing
View Details