Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIVA1 protein

This Human SIVA1 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SIVA1

UniProt

O15304

Expression Region

1-110aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-SUMO-tag and expression region is 1-110aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), Biotin conjugate, 0.1mg/mL
BNCB2282-500 1x 500 µL

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A TRITC
RP-01-5 5 mg

Protein A TRITC

Sign In for Pricing
View Details
Human DR6 (TNFRSF21) activation kit by CRISPRa
GA109078 1 Kit

Human DR6 (TNFRSF21) activation kit by CRISPRa

Sign In for Pricing
View Details
FUS Rabbit Monoclonal Antibody
TA422873 100 µL

FUS Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TRF4 2 (PAPD5) Human Gene Knockout Kit (CRISPR)
KN214986 1 Kit

TRF4 2 (PAPD5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IFNGR1 Recombinant Rabbit Monoclonal Antibody [PSH06-43] - BSA and Azide free (Capture)
HA722679 100 µL

Human IFNGR1 Recombinant Rabbit Monoclonal Antibody [PSH06-43] - BSA and Azide free (Capture)

Sign In for Pricing
View Details