Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIVA1 protein

This Human SIVA1 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SIVA1

UniProt

O15304

Expression Region

1-110aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-SUMO-tag and expression region is 1-110aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydrobromic Acid Solution (in Acetic Acid)
TRC-H714565-10ML 10 mL

Hydrobromic Acid Solution (in Acetic Acid)

Sign In for Pricing
View Details
Recombinant Human PDCD5/TFAR19 Protein (His Tag)
PKSH032867-01 10 µg

Recombinant Human PDCD5/TFAR19 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PDCD5/TFAR19 Protein (His Tag)
PKSH032867-02 50 µg

Recombinant Human PDCD5/TFAR19 Protein (His Tag)

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF568 conjugate, 0.1mg/mL
BNC681147-500 1x 500 µL

CD45RB (PTPRC/1147), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Complement C3 Recombinant Rabbit monoclonal Antibody
HA725142H 100 µL

Human Complement C3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: k1H7]
AM09029PU-N 100 µL

PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: k1H7]

Sign In for Pricing
View Details