Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PGDH protein

This Human PGDH protein spans the amino acid sequence from region 4-483aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PGDH

UniProt

P52209

Expression Region

4-483aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

79.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LAR/PTPRF Antibody (W7C6) [DyLight 650]
NBP2-90995C 0.1 mL

Mouse Monoclonal LAR/PTPRF Antibody (W7C6) [DyLight 650]

Sign In for Pricing
View Details
Recombinant ANKRD20A12P Antibody
E30AN027 100 µL

Recombinant ANKRD20A12P Antibody

Sign In for Pricing
View Details
ETAA1 Protein Vector (Rat) (pPB-N-His)
PV266663 500 ng

ETAA1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
(10E,15Z) -9,12,13-Trihydroxy-10,15-octadecadienoic acid
FT181498-01 50 µg

(10E,15Z) -9,12,13-Trihydroxy-10,15-octadecadienoic acid

Sign In for Pricing
View Details
(10E,15Z) -9,12,13-Trihydroxy-10,15-octadecadienoic acid
FT181498-02 100 µg

(10E,15Z) -9,12,13-Trihydroxy-10,15-octadecadienoic acid

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana RING-H2 finger protein ATL2 (ATL2)
orb2926918-01 20 µg

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL2 (ATL2)

Sign In for Pricing
View Details