Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PGDH protein

This Human PGDH protein spans the amino acid sequence from region 4-483aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PGDH

UniProt

P52209

Expression Region

4-483aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

79.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 700 Anti-human CD151 Antibody *50-6*
115100J0-AAT 100 Tests

IFluor® 700 Anti-human CD151 Antibody *50-6*

Sign In for Pricing
View Details
T/G-PAG, SDS, 10-25% 1.0mm 2-Dwell
KG757D 10/pk

T/G-PAG, SDS, 10-25% 1.0mm 2-Dwell

Sign In for Pricing
View Details
Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2α/PIP4K2A Protein (C-6His)
E53A05849 50 µg

Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2α/PIP4K2A Protein (C-6His)

Sign In for Pricing
View Details
VAV2 (DPH Region) Sheep Polyclonal Antibody
AP05064PU-N 250 µg

VAV2 (DPH Region) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MBD2 Antibody [DyLight 488]
NBP2-99402G 0.1 mL

Rabbit Polyclonal MBD2 Antibody [DyLight 488]

Sign In for Pricing
View Details
Cdk8 (NM_153599) Mouse Tagged ORF Clone Lentiviral Particle
MR218219L2V 200 µL

Cdk8 (NM_153599) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details