Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SEPP1 protein

This Human SEPP1 protein spans the amino acid sequence from region 20-381aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEPP1

UniProt

P49908

Expression Region

20-381aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 20-381aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CLEC18C shRNA (UAS) - Lentiviral human CLEC18C shRNA (UAS, iRFP) (100)
GTR15080247 1 Vial

Lentiviral human CLEC18C shRNA (UAS) - Lentiviral human CLEC18C shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal TRIM5 alpha Antibody [Alexa Fluor 350]
NBP1-76601AF350 0.1 mL

Rabbit Polyclonal TRIM5 alpha Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
DNAI1 Recombinant Antibody, HRP Conjugated
bsm-61602R-HRP-TR 20 µL

DNAI1 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
WDR52, CT (WDR52, WD repeat-containing protein 52) (APC) discontinued
043842-APC 200 µL

WDR52, CT (WDR52, WD repeat-containing protein 52) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Bovine RING finger protein 186 (RNF186)
MBS7028774-01 0.02 mg

Recombinant Bovine RING finger protein 186 (RNF186)

Sign In for Pricing
View Details
Recombinant Bovine RING finger protein 186 (RNF186)
MBS7028774-02 0.1 mg

Recombinant Bovine RING finger protein 186 (RNF186)

Sign In for Pricing
View Details