Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SEPP1 protein

This Human SEPP1 protein spans the amino acid sequence from region 20-381aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEPP1

UniProt

P49908

Expression Region

20-381aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 20-381aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vangl2 shRNA (UAS) - Lentiviral mouse Vangl2 shRNA (UAS, GFP) plasmid
GTR15279862 1 Vial

Lentiviral mouse Vangl2 shRNA (UAS) - Lentiviral mouse Vangl2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human/Primate MMP-9 MAb (Clone 36020R)
MAB936R-SP 25 µg

Human/Primate MMP-9 MAb (Clone 36020R)

Sign In for Pricing
View Details
Chicken Ubiquitin Carboxyl-Terminal Hydrolase 45 (USP45) ELISA Kit
MBS9945210 Inquire

Chicken Ubiquitin Carboxyl-Terminal Hydrolase 45 (USP45) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) BANP Polyclonal Antibody
MBS7195004 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) BANP Polyclonal Antibody

Sign In for Pricing
View Details
Crk p38 Rabbit Polyclonal Antibody
orb196271 100 µg

Crk p38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Apc5/ANAPC5 Antibody Picoband®, FITC Conjugate
A08280-2-FITC 100 µg/Vial

Anti-Apc5/ANAPC5 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details