Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SEPP1 protein

This Human SEPP1 protein spans the amino acid sequence from region 20-381aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEPP1

UniProt

P49908

Expression Region

20-381aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 20-381aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD7 HDR Plasmid (m)
sc-421695-HDR 20 µg

PSMD7 HDR Plasmid (m)

Sign In for Pricing
View Details
OLIG3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
33613111 3x 1.0 µg

OLIG3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HK3 Antibody
CSB-PA010471GA01HU 100 µL

HK3 Antibody

Sign In for Pricing
View Details
ADRB2 Rabbit Polyclonal Antibody (AP)
orb1595841 100 µL

ADRB2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Hmbs ORF Vector (Mouse) (pORF)
23480014 1.0 µg DNA

Hmbs ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human Plexin A4 Alexa Fluor 350 Antibody (Clone 707206)
FAB58561U-100UG 100 µg

Human Plexin A4 Alexa Fluor 350 Antibody (Clone 707206)

Sign In for Pricing
View Details