Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SEC16A protein

This Human SEC16A protein spans the amino acid sequence from region 1943-2154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEC16A

UniProt

O15027

Expression Region

2121aa-2332aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-tag and expression region is 1943-2154aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKLSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQLAQACATSGSSRLGRIGQRKHLVLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orexin B, rat, mouse (TFA)
HY-P1349A-01 1 mg

Orexin B, rat, mouse (TFA)

Sign In for Pricing
View Details
Orexin B, rat, mouse (TFA)
HY-P1349A-02 5 mg

Orexin B, rat, mouse (TFA)

Sign In for Pricing
View Details
Orexin B, rat, mouse (TFA)
HY-P1349A-03 10 mg

Orexin B, rat, mouse (TFA)

Sign In for Pricing
View Details
WFS1 Antibody
orb1558369-01 50 μL

WFS1 Antibody

Sign In for Pricing
View Details
WFS1 Antibody
orb1558369-02 100 µL

WFS1 Antibody

Sign In for Pricing
View Details
WFS1 Antibody
orb1558369-03 200 µL

WFS1 Antibody

Sign In for Pricing
View Details