Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SM22 protein

This Human SM22 protein spans the amino acid sequence from region 2-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SM22 WS3-10

UniProt

Q01995

Expression Region

2-201aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIBRARY COPIER, for Disposable, Standard Well Pin Tools, Heat Stable Polypropylene
VP 244 1 EACH

LIBRARY COPIER, for Disposable, Standard Well Pin Tools, Heat Stable Polypropylene

Sign In for Pricing
View Details
Arntl (NM_024362) Rat Tagged ORF Clone Lentiviral Particle
RR210481L4V 200 µL

Arntl (NM_024362) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GST Monoclonal Antibody
ABM40020-01 30 µL

GST Monoclonal Antibody

Sign In for Pricing
View Details
GST Monoclonal Antibody
ABM40020-02 50 µL

GST Monoclonal Antibody

Sign In for Pricing
View Details
GST Monoclonal Antibody
ABM40020-03 100 µL

GST Monoclonal Antibody

Sign In for Pricing
View Details
GST Monoclonal Antibody
ABM40020-04 200 µL

GST Monoclonal Antibody

Sign In for Pricing
View Details