Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SM22 protein

This Human SM22 protein spans the amino acid sequence from region 2-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SM22 WS3-10

UniProt

Q01995

Expression Region

2-201aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Matrix Metalloproteinase 16 (MMP16) ELISA Kit
DLR-MMP16-Hu-01 48 Tests

Human Matrix Metalloproteinase 16 (MMP16) ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 16 (MMP16) ELISA Kit
DLR-MMP16-Hu-02 96 Tests

Human Matrix Metalloproteinase 16 (MMP16) ELISA Kit

Sign In for Pricing
View Details
TP53I11 Rabbit Polyclonal Antibody (PerCP)
orb2395037 100 µL

TP53I11 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Anti-p57 antibody
STJ98302 100 µl

Anti-p57 antibody

Sign In for Pricing
View Details
I-309 shRNA Plasmid (h)
sc-39354-SH 20 µg

I-309 shRNA Plasmid (h)

Sign In for Pricing
View Details
PSMD3 Antibody - N-terminal region : Biotin (ARP56479_P050-Biotin)
ARP56479_P050-Biotin 100 µL

PSMD3 Antibody - N-terminal region : Biotin (ARP56479_P050-Biotin)

Sign In for Pricing
View Details