Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANX6 protein

This Human ANX6 protein spans the amino acid sequence from region 2-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANX6

UniProt

P08133

Expression Region

2-245aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgA2 ELISA Kit
E019259 1 Each

Human IgA2 ELISA Kit

Sign In for Pricing
View Details
RBMXL1 (NM_001162536) Human Tagged ORF Clone Lentiviral Particle
RC228870L4V 200 µL

RBMXL1 (NM_001162536) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Freeze-dried Dengue Virus I /II /III /IV Nucleic Acid Detection Kit (Fluorescence PCR)
HWTS-FE004G 1 Kit

Freeze-dried Dengue Virus I /II /III /IV Nucleic Acid Detection Kit (Fluorescence PCR)

Sign In for Pricing
View Details
Rabbit Polyclonal RGM-B Antibody
NBP2-93453-0.02mL 0.02 mL

Rabbit Polyclonal RGM-B Antibody

Sign In for Pricing
View Details
Milk, Chimpanzee
M3896-84C 500 µL

Milk, Chimpanzee

Sign In for Pricing
View Details
Hif1an ORF Vector (Mouse) (pORF)
23261014 1.0 µg DNA

Hif1an ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details