Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANX6 protein

This Human ANX6 protein spans the amino acid sequence from region 2-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANX6

UniProt

P08133

Expression Region

2-245aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM41 (NM_018301) Human Untagged Clone
SC113606 10 µg

RBM41 (NM_018301) Human Untagged Clone

Sign In for Pricing
View Details
Anti-CYP26A1 Polyclonal Antibody
HT346024-01 50 µg

Anti-CYP26A1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYP26A1 Polyclonal Antibody
HT346024-02 100 µg

Anti-CYP26A1 Polyclonal Antibody

Sign In for Pricing
View Details
FNBP1L, CT (Formin-binding Protein 1-like, Transducer of Cdc42-dependent Actin Assembly Protein 1, Toca-1, C1orf39, TOCA1) discontinued
F6002-63A 50 µg

FNBP1L, CT (Formin-binding Protein 1-like, Transducer of Cdc42-dependent Actin Assembly Protein 1, Toca-1, C1orf39, TOCA1) discontinued

Sign In for Pricing
View Details
Goat anti-Apolipoprotein M (mouse) Antibody
dAP-1583 50 µg

Goat anti-Apolipoprotein M (mouse) Antibody

Sign In for Pricing
View Details
FAM177A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV725100 1.0 µg DNA

FAM177A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details