Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANX6 protein

This Human ANX6 protein spans the amino acid sequence from region 2-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANX6

UniProt

P08133

Expression Region

2-245aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OXTR Antibody
NBP2-82300-0.1mL 0.1 mL

Rabbit Polyclonal OXTR Antibody

Sign In for Pricing
View Details
ABCB10 Polyclonal Antibody
MBS8521026-01 0.1 mg

ABCB10 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB10 Polyclonal Antibody
MBS8521026-02 0.1 mL (AF635)

ABCB10 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB10 Polyclonal Antibody
MBS8521026-03 0.1 mL (AF610)

ABCB10 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB10 Polyclonal Antibody
MBS8521026-04 0.1 mL (AF405S)

ABCB10 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB10 Polyclonal Antibody
MBS8521026-05 0.1 mL (AF405L)

ABCB10 Polyclonal Antibody

Sign In for Pricing
View Details