Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCP2 protein

This Human SCP2 protein spans the amino acid sequence from region 1-143. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SCP2

UniProt

P22307

Expression Region

1-143

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform SCP2 of GST-tag and expression region is 1-143

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LSS Protein Lysate 20ug
IHULSSPLLY20UG 20 µg

Human LSS Protein Lysate 20ug

Sign In for Pricing
View Details
Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit
MBS7235700-01 48 Well

Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit

Sign In for Pricing
View Details
Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit
MBS7235700-02 96 Well

Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit

Sign In for Pricing
View Details
Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit
MBS7235700-03 5x 96 Well

Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit

Sign In for Pricing
View Details
Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit
MBS7235700-04 10x 96 Well

Goat Anaphase-promoting complex subunit 1 (ANAPC1) ELISA Kit

Sign In for Pricing
View Details
Kruppel Like Factor 15 (KLF15) CLIA Kit
MBS2709437-01 24 Strip Well

Kruppel Like Factor 15 (KLF15) CLIA Kit

Sign In for Pricing
View Details