Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse S100a9 protein

This Mouse S100a9 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100a9

UniProt

P31725

Expression Region

2-113aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-113aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CoaD Antibody
orb812020 2 mg

CoaD Antibody

Sign In for Pricing
View Details
MSL3 (MSL3L1) discontinued
511730 100 µg

MSL3 (MSL3L1) discontinued

Sign In for Pricing
View Details
CRYBB2 siRNA (Rat)
orb1833246-01 15 nmol

CRYBB2 siRNA (Rat)

Sign In for Pricing
View Details
CRYBB2 siRNA (Rat)
orb1833246-02 30 nmol

CRYBB2 siRNA (Rat)

Sign In for Pricing
View Details
Olfactory receptor 4X1 Polyclonal Antibody
RA28139-01 50 µL

Olfactory receptor 4X1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 4X1 Polyclonal Antibody
RA28139-02 100 µL

Olfactory receptor 4X1 Polyclonal Antibody

Sign In for Pricing
View Details