Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A6 protein

This Human S100A6 protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100A6

UniProt

P06703

Expression Region

1-90aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-90aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DSG3 qPCR Primer Pair
QH13441S 200 Tests

Human DSG3 qPCR Primer Pair

Sign In for Pricing
View Details
EGR4 (NM_001965) Human Over-expression Lysate
LS001961-20ug 20 µg

EGR4 (NM_001965) Human Over-expression Lysate

Sign In for Pricing
View Details
P53 discontinued
403277-01 50 µL

P53 discontinued

Sign In for Pricing
View Details
P53 discontinued
403277-02 100 µL

P53 discontinued

Sign In for Pricing
View Details
Cholesteryl butyl ether
C20790 25 mg

Cholesteryl butyl ether

Sign In for Pricing
View Details
KDR Antibody
MBS7122016-01 0.05 mg

KDR Antibody

Sign In for Pricing
View Details