Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A6 protein

This Human S100A6 protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100A6

UniProt

P06703

Expression Region

1-90aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-90aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MGAM Antibody Picoband®
A07347 100 µg/Vial

Anti-MGAM Antibody Picoband®

Sign In for Pricing
View Details
MAS1L Antibody
orb2679555-01 50 µL

MAS1L Antibody

Sign In for Pricing
View Details
MAS1L Antibody
orb2679555-02 100 µL

MAS1L Antibody

Sign In for Pricing
View Details
MAS1L Antibody
orb2679555-03 200 µL

MAS1L Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CYTL1 Polyclonal Antibody
PA90034HU-01 50 µg

Rabbit Anti-Human CYTL1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CYTL1 Polyclonal Antibody
PA90034HU-02 100 µg

Rabbit Anti-Human CYTL1 Polyclonal Antibody

Sign In for Pricing
View Details