Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A4 protein

This Human S100A4 protein spans the amino acid sequence from region 2-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100A4

UniProt

P26447

Expression Region

2-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-101aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPXM1 Rabbit Polyclonal Antibody
MBS9514040-01 0.05 mL

CPXM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPXM1 Rabbit Polyclonal Antibody
MBS9514040-02 0.1 mL

CPXM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPXM1 Rabbit Polyclonal Antibody
MBS9514040-03 5x 0.1 mL

CPXM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tppp2 3'UTR GFP Stable Cell Line
TU272353 1.0 mL

Tppp2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TRNAM9 Protein Vector (Human) (pPM-C-HA)
PV139532 500 ng

TRNAM9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human THG1L shRNA (UAS) - Lentiviral human THG1L shRNA (UAS, RFP) (25)
GTR15096923 1 Vial

Lentiviral human THG1L shRNA (UAS) - Lentiviral human THG1L shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details