Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A11 protein

This Human S100A11 protein spans the amino acid sequence from region 2-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100A11

UniProt

P31949

Expression Region

2-105aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-105aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipoamide Dehydrogenase/DLD Rabbit Polyclonal Antibody
orb27677 100 µg

Lipoamide Dehydrogenase/DLD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
[One Step] PSMA5 Antibody Kit
MBS9145362-01 0.02 mL

[One Step] PSMA5 Antibody Kit

Sign In for Pricing
View Details
[One Step] PSMA5 Antibody Kit
MBS9145362-02 0.1 mL

[One Step] PSMA5 Antibody Kit

Sign In for Pricing
View Details
[One Step] PSMA5 Antibody Kit
MBS9145362-03 5x 0.1 mL

[One Step] PSMA5 Antibody Kit

Sign In for Pricing
View Details
Tnnt3 ORF Vector (Mouse) (pORF)
ORF060142 1.0 µg DNA

Tnnt3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Human ENSA Protein, N-His
orb2832375-01 20 µg

Recombinant Human ENSA Protein, N-His

Sign In for Pricing
View Details