Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RORC protein

This Human RORC protein spans the amino acid sequence from region 1-518aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NR1F3, Nuclear receptor ROR gamma, Nuclear receptor ROR-gamma, Nuclear receptor RZR gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, RAR related orphan nuclear receptor variant 2, RAR related orphan receptor C

UniProt

P51449

Expression Region

1-518aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

74.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ML251
BA2115-10 10 mg

ML251

Sign In for Pricing
View Details
RNF2P sgRNA CRISPR Lentivector (Human) (Target 2)
K1833803 1.0 µg DNA

RNF2P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal WNK1 Antibody (M42-P3B10) [Janelia Fluor 646]
NBP2-50364JF646 0.1 mL

Mouse Monoclonal WNK1 Antibody (M42-P3B10) [Janelia Fluor 646]

Sign In for Pricing
View Details
Calpain 7 (CAPN7) (NM_014296) Human Recombinant Protein
TP308200 20 µg

Calpain 7 (CAPN7) (NM_014296) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Melanotropin beta Antibody (r57) [DyLight 550]
NBP2-54342R 100 µL

Mouse Monoclonal Melanotropin beta Antibody (r57) [DyLight 550]

Sign In for Pricing
View Details
TSSK4 Antibody
A68931-100UL 100 µL

TSSK4 Antibody

Sign In for Pricing
View Details