Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ROPN1B protein

This Human ROPN1B protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ROPN1B

UniProt

Q9BZX4

Expression Region

1-120aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform 2 of GST-tag and expression region is 1-120aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit
MBS1611260-01 48 Well

Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit

Sign In for Pricing
View Details
Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit
MBS1611260-02 96 Well

Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit

Sign In for Pricing
View Details
Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit
MBS1611260-03 5x 96 Well

Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit

Sign In for Pricing
View Details
Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit
MBS1611260-04 10x 96 Well

Human Sialic acid-binding Ig-like lectin 9, SIGLEC9 ELISA Kit

Sign In for Pricing
View Details
PSME3 (NM_176863) Human Tagged Lenti ORF Clone
RC222312L2 10 µg

PSME3 (NM_176863) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PRAMEF15 (NM_001098376) Human Tagged ORF Clone Lentiviral Particle
RC224045L4V 200 µL

PRAMEF15 (NM_001098376) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details