Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ROPN1B protein

This Human ROPN1B protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ROPN1B

UniProt

Q9BZX4

Expression Region

1-120aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform 2 of GST-tag and expression region is 1-120aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS 15203
orb2900997-01 1 g

MS 15203

Sign In for Pricing
View Details
MS 15203
orb2900997-02 5 mg

MS 15203

Sign In for Pricing
View Details
MS 15203
orb2900997-03 10 mg

MS 15203

Sign In for Pricing
View Details
MS 15203
orb2900997-04 25 mg

MS 15203

Sign In for Pricing
View Details
MS 15203
orb2900997-05 50 mg

MS 15203

Sign In for Pricing
View Details
MS 15203
orb2900997-06 100 mg

MS 15203

Sign In for Pricing
View Details