Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNF7 protein

This Human RNF7 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNF7

UniProt

Q9UBF6

Expression Region

2-113aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 2-113aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH3A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3946R-BF680-01 20 µL

IDH3A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
IDH3A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3946R-BF680-02 100 µL

IDH3A Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Multiple Tumor Matched Tumor & Normal Tissue MicroArray
NBP2-78114 5 Slides

Multiple Tumor Matched Tumor & Normal Tissue MicroArray

Sign In for Pricing
View Details
(3R,7Z,10Z,13Z,16Z) -3-Hydroxydocosatetraenoyl-CoA
HY-CE00388 1 Each

(3R,7Z,10Z,13Z,16Z) -3-Hydroxydocosatetraenoyl-CoA

Sign In for Pricing
View Details
PSMB1, CT (Proteasome gamma Chain, Multicatalytic Endopeptidase Complex Subunit C5, Macropain Subunit C5, Proteasome Component C5, Proteasome Subunit beta Type-1, PSC5) (PE) discontinued
P9078-38E-PE 200 µL

PSMB1, CT (Proteasome gamma Chain, Multicatalytic Endopeptidase Complex Subunit C5, Macropain Subunit C5, Proteasome Component C5, Proteasome Subunit beta Type-1, PSC5) (PE) discontinued

Sign In for Pricing
View Details
Zwf Antibody (HRP)
orb344356 25 µL

Zwf Antibody (HRP)

Sign In for Pricing
View Details