Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNF7 protein

This Human RNF7 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNF7

UniProt

Q9UBF6

Expression Region

2-113aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 2-113aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplirun® Coxsackie B1 RNA Control
N15-MBC061 12500 - 20000 c/µL

Amplirun® Coxsackie B1 RNA Control

Sign In for Pricing
View Details
ALOX12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV655267 1.0 µg DNA

ALOX12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD27 Ligand/CD70 Trimer, His, Human
Z04180-100 100 µg

CD27 Ligand/CD70 Trimer, His, Human

Sign In for Pricing
View Details
KIF24, NT (KIF24, C9orf48, Kinesin-like protein KIF24)
037438 200 µL

KIF24, NT (KIF24, C9orf48, Kinesin-like protein KIF24)

Sign In for Pricing
View Details
Refrigerated Circulator, 7L Space-Saving, Advanced Programmable (-20° to 200°C), 120V, 60Hz
AP07R-20-A11B 1 Each

Refrigerated Circulator, 7L Space-Saving, Advanced Programmable (-20° to 200°C), 120V, 60Hz

Sign In for Pricing
View Details
FOXI3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
20775064 1.0 µg DNA

FOXI3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details