Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RETN protein

This Bovine RETN protein spans the amino acid sequence from region 19-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RETN

UniProt

Q762I5

Expression Region

19-109aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 19-109aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r118 Mouse Gene Knockout Kit (CRISPR)
KN518919 1 Kit

Vmn1r118 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ODF3 activation kit by CRISPRa
GA114416 1 Kit

Human ODF3 activation kit by CRISPRa

Sign In for Pricing
View Details
LOC158473 Human qPCR Primer Pair (XM_041020)
HP220776 200 Reactions

LOC158473 Human qPCR Primer Pair (XM_041020)

Sign In for Pricing
View Details
PCB (PC) (NM_000920) Human Over-expression Lysate
LC400340 20 µg

PCB (PC) (NM_000920) Human Over-expression Lysate

Sign In for Pricing
View Details
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF568 conjugate, 0.1mg/mL
BNC682752-500 1x 500 µL

Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), 0.2mg/mL
BNUB2223-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), 0.2mg/mL

Sign In for Pricing
View Details