Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RETN protein

This Bovine RETN protein spans the amino acid sequence from region 19-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RETN

UniProt

Q762I5

Expression Region

19-109aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 19-109aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HNRNPM Antibody
RC-4601-01 50 μL

Recombinant HNRNPM Antibody

Sign In for Pricing
View Details
Recombinant HNRNPM Antibody
RC-4601-02 100 µL

Recombinant HNRNPM Antibody

Sign In for Pricing
View Details
Recombinant HNRNPM Antibody
RC-4601-03 1 mL

Recombinant HNRNPM Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-
LA-6701-1 1 mg

Alkaline Phosphatase Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-

Sign In for Pricing
View Details
CYP2W1 Polyclonal Antibody
E-AB-11119-01 20 µL

CYP2W1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP2W1 Polyclonal Antibody
E-AB-11119-02 60 µL

CYP2W1 Polyclonal Antibody

Sign In for Pricing
View Details