Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human REG3A protein

This Human REG3A protein spans the amino acid sequence from region 27-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

REG3A

UniProt

Q06141

Expression Region

27-175aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 27-175aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF2/TSPAN7, Cynomolgus (HEK293, Fc)
HY-P77496 1 Each

TM4SF2/TSPAN7, Cynomolgus (HEK293, Fc)

Sign In for Pricing
View Details
XCR1 Antibody
orb2676755-01 50 µL

XCR1 Antibody

Sign In for Pricing
View Details
XCR1 Antibody
orb2676755-02 100 µL

XCR1 Antibody

Sign In for Pricing
View Details
XCR1 Antibody
orb2676755-03 200 µL

XCR1 Antibody

Sign In for Pricing
View Details
Human EPB41L1 Protein Lysate
MBS8411131-01 0.02 mg

Human EPB41L1 Protein Lysate

Sign In for Pricing
View Details
Human EPB41L1 Protein Lysate
MBS8411131-02 5x 0.02 mg

Human EPB41L1 Protein Lysate

Sign In for Pricing
View Details