Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RBP3 protein

This Bovine RBP3 protein spans the amino acid sequence from region 933-1231aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RBP3

UniProt

P12661

Expression Region

933-1231aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of GST-tag and expression region is 633-1231aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein
TP306003L 1 mg

Cytohesin 3 (CYTH3) (NM_004227) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS700827 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Homogenizer BLHM-901
BLHM-901 1 Unit

Homogenizer BLHM-901

Sign In for Pricing
View Details
Mouse Cdc7 activation kit by CRISPRa
GA200654 1 Kit

Mouse Cdc7 activation kit by CRISPRa

Sign In for Pricing
View Details
GRAP2 Human Gene Knockout Kit (CRISPR)
KN206546 1 Kit

GRAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624771 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details