Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFSF13B protein

This Human TNFSF13B protein spans the amino acid sequence from region 68-285aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNFSF13B

UniProt

Q9Y275

Expression Region

68-285aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 Antibody (RPE)
orb433527 100 Tests

CD163 Antibody (RPE)

Sign In for Pricing
View Details
BCMP11 Rabbit Polyclonal Antibody (HRP)
orb468468 100 µL

BCMP11 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TRPA1 Protein Vector (Human) (pPB-N-His)
PV140639 500 ng

TRPA1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Triethoxy (octyl) silane
468106-01 10 g

Triethoxy (octyl) silane

Sign In for Pricing
View Details
Triethoxy (octyl) silane
468106-02 25 g

Triethoxy (octyl) silane

Sign In for Pricing
View Details
SLC5A5 Protein Vector (Mouse) (pPM-C-HA)
PV231168 500 ng

SLC5A5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details