Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TLN2 protein

This Human TLN2 protein spans the amino acid sequence from region 88-406aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TLN2

UniProt

Q9Y4G6

Expression Region

88-406aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIRE Polyclonal Antibody
E-AB-90748-01 60 µL

AIRE Polyclonal Antibody

Sign In for Pricing
View Details
AIRE Polyclonal Antibody
E-AB-90748-02 120 µL

AIRE Polyclonal Antibody

Sign In for Pricing
View Details
AIRE Polyclonal Antibody
E-AB-90748-03 200 µL

AIRE Polyclonal Antibody

Sign In for Pricing
View Details
SEPT2 Polyclonal Antibody
E-AB-17022-01 20 µL

SEPT2 Polyclonal Antibody

Sign In for Pricing
View Details
SEPT2 Polyclonal Antibody
E-AB-17022-02 60 µL

SEPT2 Polyclonal Antibody

Sign In for Pricing
View Details
SEPT2 Polyclonal Antibody
E-AB-17022-03 120 µL

SEPT2 Polyclonal Antibody

Sign In for Pricing
View Details