Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAM16 protein

This Human PAM16 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAM16

UniProt

Q9Y3D7

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 Mouse Monoclonal Antibody
E10G20426 100 µL

Cytokeratin 8 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
NAV1 Antibody
ABD9694 100 µg

NAV1 Antibody

Sign In for Pricing
View Details
CDK2AP1 (Cyclin-dependent Kinase 2-associated Protein 1, CDK2-associated Protein 1, Deleted in Oral Cancer 1, DOC-1, Putative Oral Cancer Suppressor, CDKAP1, DOC1)
124779 50 µg

CDK2AP1 (Cyclin-dependent Kinase 2-associated Protein 1, CDK2-associated Protein 1, Deleted in Oral Cancer 1, DOC-1, Putative Oral Cancer Suppressor, CDKAP1, DOC1)

Sign In for Pricing
View Details
Methyl 4-fluoro-1H-indazole-6-carboxylate
PC111411-01 250 mg

Methyl 4-fluoro-1H-indazole-6-carboxylate

Sign In for Pricing
View Details
Methyl 4-fluoro-1H-indazole-6-carboxylate
PC111411-02 1 g

Methyl 4-fluoro-1H-indazole-6-carboxylate

Sign In for Pricing
View Details
Methyl 4-fluoro-1H-indazole-6-carboxylate
PC111411-03 5 g

Methyl 4-fluoro-1H-indazole-6-carboxylate

Sign In for Pricing
View Details