Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAM16 protein

This Human PAM16 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAM16

UniProt

Q9Y3D7

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Monoclonal Goat anti-Mouse IgG F(ab) Secondary Antibody (RMG05) [Unconjugated]
NBP2-62016 100 µg

Goat Monoclonal Goat anti-Mouse IgG F(ab) Secondary Antibody (RMG05) [Unconjugated]

Sign In for Pricing
View Details
Proteasome 26S S3 Polyclonal Antibody, PerCP Conjugated
bs-9347R-PerCP 100 µL

Proteasome 26S S3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
CD20 Antibody (YA6136, Rabbit)
HY-P86444-01 10 µL

CD20 Antibody (YA6136, Rabbit)

Sign In for Pricing
View Details
CD20 Antibody (YA6136, Rabbit)
HY-P86444-02 50 μL

CD20 Antibody (YA6136, Rabbit)

Sign In for Pricing
View Details
CD20 Antibody (YA6136, Rabbit)
HY-P86444-03 100 µL

CD20 Antibody (YA6136, Rabbit)

Sign In for Pricing
View Details
Succinylated Triticum vulgaris Lectin (Succ WGA) - Separopore® 4B
30330049-2 5 mL

Succinylated Triticum vulgaris Lectin (Succ WGA) - Separopore® 4B

Sign In for Pricing
View Details