Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAM16 protein

This Human PAM16 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAM16

UniProt

Q9Y3D7

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIIA-γ (D-6) Alexa Fluor® 488
sc-374483 AF488 200 µg/mL

TFIIA-γ (D-6) Alexa Fluor® 488

Sign In for Pricing
View Details
Ginsenoside Rg1
C09747-100mg 100 mg

Ginsenoside Rg1

Sign In for Pricing
View Details
CD44v7 Rabbit Polyclonal Antibody (BF680)
orb1601988 100 µL

CD44v7 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Chicken Parathyroid Hormone Receptor 1 ELISA Kit
MBS108571 Inquire

Chicken Parathyroid Hormone Receptor 1 ELISA Kit

Sign In for Pricing
View Details
RECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs, hRECK, Suppressor of Tumorigenicity 15 Protein, ST15) (FITC)
132451-FITC 100 µL

RECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs, hRECK, Suppressor of Tumorigenicity 15 Protein, ST15) (FITC)

Sign In for Pricing
View Details
Cox4nb siRNA Oligos set (Rat)
16682176 3x 5 nmol

Cox4nb siRNA Oligos set (Rat)

Sign In for Pricing
View Details