Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PVALB protein

This Human PVALB protein spans the amino acid sequence from region 2-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PVALB

UniProt

P20472

Expression Region

2-110aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-110aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H4K5AC Antibody
orb1259609 100 µL

H4K5AC Antibody

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG (H&L) - APC
CSA4818-01 100 µL

Rabbit Anti-Goat IgG (H&L) - APC

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG (H&L) - APC
CSA4818-02 500 μL

Rabbit Anti-Goat IgG (H&L) - APC

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG (H&L) - APC
CSA4818-03 1 mL

Rabbit Anti-Goat IgG (H&L) - APC

Sign In for Pricing
View Details
MAP2K3 siRNA (Human)
CRH3776-01 15 nmol

MAP2K3 siRNA (Human)

Sign In for Pricing
View Details
MAP2K3 siRNA (Human)
CRH3776-02 30 nmol

MAP2K3 siRNA (Human)

Sign In for Pricing
View Details